PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv6_139660_wjii.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family HD-ZIP
Protein Properties Length: 217aa    MW: 25185.2 Da    PI: 6.5219
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv6_139660_wjii.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.82.1e-1949102356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k++++++eq++ Le  F  ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Bv6_139660_wjii.t1  49 KKRKLSEEQVNMLEISFGCEHKLESERKDRLASELGLDPRQVAVWFQNRRARWK 102
                         56699************************************************9 PP

2HD-ZIP_I/II119.61.6e-3849140293
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         kkr+ls+eqv++LE sF  e+kLe+erK +la+eLgl+prqvavWFqnrRAR+k+k+lE++y++L++++++ + e++rLe+ev +L+++l+
  Bv6_139660_wjii.t1  49 KKRKLSEEQVNMLEISFGCEHKLESERKDRLASELGLDPRQVAVWFQNRRARWKSKKLEHEYTKLRNEHEKNVVEKCRLETEVLSLKDQLN 139
                         9***************************************************************************************997 PP

         HD-ZIP_I/II  93 e 93 
                         +
  Bv6_139660_wjii.t1 140 D 140
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.47144104IPR001356Homeobox domain
SMARTSM003899.4E-1947108IPR001356Homeobox domain
CDDcd000865.50E-1649105No hitNo description
PfamPF000461.1E-1649102IPR001356Homeobox domain
SuperFamilySSF466893.38E-1749114IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.9E-2051110IPR009057Homeodomain-like
PRINTSPR000311.4E-57584IPR000047Helix-turn-helix motif
PROSITE patternPS00027079102IPR017970Homeobox, conserved site
PRINTSPR000311.4E-584100IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MQGDQEDPVG LMSELYSGLY TQMAPQQEDQ PKRRRRRKSK SEGMNSAAKK RKLSEEQVNM  60
LEISFGCEHK LESERKDRLA SELGLDPRQV AVWFQNRRAR WKSKKLEHEY TKLRNEHEKN  120
VVEKCRLETE VLSLKDQLND AKREIQKLQE RSATSSSADN ISSNSPSSSL TMDHHPNVID  180
PHLLEEQFGT GGCFDSMFYV PDSNYVPSMD WVDLYNM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13136KRRRRR
23137KRRRRRK
33351RRRRKSKSEGMNSAAKKRK
43439RRRKSK
53551RRKSKSEGMNSAAKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010681120.11e-163PREDICTED: homeobox-leucine zipper protein ATHB-40-like
SwissprotQ9ZU704e-66ATB21_ARATH; Homeobox-leucine zipper protein ATHB-21
TrEMBLA0A0J8C9L61e-163A0A0J8C9L6_BETVU; Uncharacterized protein
STRINGPOPTR_0005s12760.14e-70(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.17e-60homeobox protein 40